Maxadilan trifluoroacetate salt,CAS :135374-80-0
Maxadilan trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-923 | 0.5mg | 900.00 | + Add to cart |
|
R-M-923 | 1mg | 1510.00 | + Add to cart |
|
|
Product description
Maxadilan, isolated from the salivary gland of the sand fly Lutzomyia longipalpis, is a potent vasodilator. The peptide specifically and potently activates the mammalian PAC1 receptor, one of the three receptors for PACAP.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 135374-80-0 |
Sequence | CDATCQFRKAIDDCQKQAHHSNVLQTSVQTTATFTSMDTSQLPGNSVFKECMKQKKKEFKA-NH₂ |
Molecular Formula | C₂₉₁H₄₆₆N₈₆O₉₄S₆ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product